PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00010089-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family WOX
Protein Properties Length: 387aa    MW: 42711.4 Da    PI: 7.1312
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00010089-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-1850110257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         ++R+++++eq+++Le+ F++   +ps++e++++ ++l    ++ +++V++WFqNr+ + k+
  WALNUT_00010089-RA  50 KPRWNPKPEQIRILEAIFNSgMVNPSRDEIRKIRAQLqeygQVGDANVFYWFQNRKSRSKH 110
                         89*****************99*************************************995 PP

2Wus_type_Homeobox112.32.6e-3649111264
   Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                         +++RW+P+peQi+iLe++++sG+++P+++ei++i+a+L+eyG+++d+NVfyWFQNrk+R+++k
  WALNUT_00010089-RA  49 PKPRWNPKPEQIRILEAIFNSGMVNPSRDEIRKIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 111
                         689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-735109IPR009057Homeodomain-like
PROSITE profilePS5007111.01346111IPR001356Homeobox domain
SuperFamilySSF466892.48E-1247114IPR009057Homeodomain-like
SMARTSM003894.5E-1048115IPR001356Homeobox domain
CDDcd000861.38E-949111No hitNo description
PfamPF000462.9E-1650110IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPCNTH HQWQHDINSC DRGPNTSVPG CEQERSPEPK PRWNPKPEQI  60
RILEAIFNSG MVNPSRDEIR KIRAQLQEYG QVGDANVFYW FQNRKSRSKH KLRHLQNSKN  120
QSQHTQNNLP INSLAAAINA PSSSSFSSEK SSPKAPQMMT TSKRAFPNVT DASNSPTASV  180
NHTFFQSRGE NLPEPFFFPV QQITGDQVHH NVGTASFTQG FCFPELSNAV QVPGHDTVGP  240
CTSLLISEIM NHGDSEKSLE DEKAMKFFHH QQNYAVTTHP ITHTTAVSPS TTATNYTGTV  300
SSPIDQVQGV GESGAVGTGG PAKSTVFINE VAFEVATGPF NVREAFGDDA VLIHSSGQPL  360
ITNEWGVTLQ PLLDGAFYYL VRAFDFN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007025495.11e-167Homeobox-3, putative
SwissprotQ6X7J42e-87WOX9_ARATH; WUSCHEL-related homeobox 9
TrEMBLA0A061GG541e-167A0A061GG54_THECC; Homeobox-3, putative
STRINGVIT_10s0003g00560.t011e-145(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.12e-87homeobox-3